Atur jumlah dan catatan
Stok Total: Sisa 1
Subtotal
Rp12.235.000
Interferon gamma antibody 100 μg (orb547790) - biorbyt
Rp12.235.000
- Kondisi: Baru
- Min. Pemesanan: 1 Buah
- Etalase: Antibody
Product Name: Interferon gamma antibody
Catalog Number: orb547790
Species/Host: Mouse
Reactivity: Human, Mouse, Rat
Conjugation: Unconjugated
Tested applications: FACS, IF, IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED)
Target: Interferon gamma
Alternative Names: AIFM1 antibody, AIFM1_HUMAN antibody, Apoptosis inducing factor 1, mitochondrial antibody, Apoptosis inducing factor antibody, Apoptosis inducing factor, mitochondrion associated, 1 antibody, Apoptosis-inducing factor 1 antibody, CMTX4 antibody, COXPD6 antibody, Harlequin antibody, Hq antibody, mAIF antibody, MGC111425 antibody, MGC5706 antibody, mitochondrial antibody
Form/Appearance: Lyophilized: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Storage: Store at 4°C. Upon delivery aliquot and store at -20°C for one year. Avoid freeze/thaw cycles.
Note: For research use only.
Reconstitution: Add 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Isotype: IgG1
Clonality: Monoclonal
Purity: Immunogen affinity purified.
Clone ID: 2I5
Uniprot ID: P55008
Entrez: 33390
Dilution Range: WB: 0.1-0.5μg/ml, IHC-P: 0.5-1μg/ml, IF: 2μg/ml, FACS: 1-3μg/1x106 cells
Description: Mouse monoclonal antibody to Interferon gamma
Catalog Number: orb547790
Species/Host: Mouse
Reactivity: Human, Mouse, Rat
Conjugation: Unconjugated
Tested applications: FACS, IF, IHC-P, WB
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED)
Target: Interferon gamma
Alternative Names: AIFM1 antibody, AIFM1_HUMAN antibody, Apoptosis inducing factor 1, mitochondrial antibody, Apoptosis inducing factor antibody, Apoptosis inducing factor, mitochondrion associated, 1 antibody, Apoptosis-inducing factor 1 antibody, CMTX4 antibody, COXPD6 antibody, Harlequin antibody, Hq antibody, mAIF antibody, MGC111425 antibody, MGC5706 antibody, mitochondrial antibody
Form/Appearance: Lyophilized: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Storage: Store at 4°C. Upon delivery aliquot and store at -20°C for one year. Avoid freeze/thaw cycles.
Note: For research use only.
Reconstitution: Add 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Isotype: IgG1
Clonality: Monoclonal
Purity: Immunogen affinity purified.
Clone ID: 2I5
Uniprot ID: P55008
Entrez: 33390
Dilution Range: WB: 0.1-0.5μg/ml, IHC-P: 0.5-1μg/ml, IF: 2μg/ml, FACS: 1-3μg/1x106 cells
Description: Mouse monoclonal antibody to Interferon gamma
Ada masalah dengan produk ini?
ULASAN PEMBELI

Belum ada ulasan untuk produk ini
Beli produk ini dan jadilah yang pertama memberikan ulasan